PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MDP0000652760
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Malus
Family WRKY
Protein Properties Length: 187aa    MW: 20540.6 Da    PI: 8.8091
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MDP0000652760genomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY110.86.1e-351067259
                   --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
           WRKY  2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59
                   +Dgy+WrKYGqK vk+s+fprsYYrCtsa+C+vkk+vers +dp++v++tYeg+H+h+
  MDP0000652760 10 EDGYRWRKYGQKAVKNSPFPRSYYRCTSASCNVKKRVERSFDDPSIVVTTYEGQHTHP 67
                   8********************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.806.3E-34269IPR003657WRKY domain
SuperFamilySSF1182904.58E-30369IPR003657WRKY domain
PROSITE profilePS5081131.915469IPR003657WRKY domain
SMARTSM007742.3E-41968IPR003657WRKY domain
PfamPF031061.2E-271067IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 187 aa     Download sequence    Send to blast
MTKSEVDHLE DGYRWRKYGQ KAVKNSPFPR SYYRCTSASC NVKKRVERSF DDPSIVVTTY  60
EGQHTHPSPL LPRPTLTSAS SXASASPFAP NNFAMPLIPT RTLFPHHYQQ VEPFADNSSP  120
PSSAPFNFGN YHVNGSSSSL TNATSTTTGL VHPERRFCSP ATGSALLADH GLLQDIVPSH  180
MLKQEQ*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A1e-28169977Probable WRKY transcription factor 4
2lex_A1e-28169977Probable WRKY transcription factor 4
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Mdo.68970.0fruit| leaf| root
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJX1129110.0JX112911.1 Malus hupehensis WRKY transcription factor 23 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008348682.11e-136PREDICTED: probable WRKY transcription factor 23
RefseqXP_008381435.11e-136PREDICTED: probable WRKY transcription factor 23
SwissprotO229004e-54WRK23_ARATH; Probable WRKY transcription factor 23
TrEMBLV9MHQ61e-126V9MHQ6_9R
STRINGPOPTR_0002s19390.11e-63(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF100234114
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G47260.12e-41WRKY DNA-binding protein 23